General Information

  • ID:  hor005576
  • Uniprot ID:  P04204
  • Protein name:  Exendin-2-long
  • Gene name:  NA
  • Organism:  Heloderma suspectum (Gila monster)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Expressed by the venom gland. Not expressed in the pancreas, liver, stomach, small intestine, lung, heart, kidney, spleen, ovary, and brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Heloderma (genus), Helodermatidae (family), Neoanguimorpha, Anguimorpha (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP
  • Length:  35(47-81)
  • Propeptide:  MKSILWLCVFGLLIATLFPVSWQMAIKSRLSSEDSETDQRLFESKRHSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPPPSR
  • Signal peptide:  MKSILWLCVFGLLIATLFPVSWQ
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces hypotension that is mediated by relaxation of cardiac smooth muscle
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C6EVG2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005576_AF2.pdbhor005576_ESM.pdb

Physical Information

Mass: 445307 Formula: C176H282N44O52
Absent amino acids: CMNVW Common amino acids: L
pI: 9.1 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 13
Hydrophobicity: -13.71 Boman Index: -3601
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 100.57
Instability Index: 6356 Extinction Coefficient cystines: 2980
Absorbance 280nm: 87.65

Literature

  • PubMed ID:  6439576
  • Title:  Primary structure of helodermin, a VIP-secretin-like peptide isolated from Gila monster venom.